Reference: | H00051053-M02 |
Product name: | GMNN monoclonal antibody (M02), clone 1B10 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant GMNN. |
Clone: | 1B10 |
Isotype: | IgG2a Kappa |
Gene id: | 51053 |
Gene name: | GMNN |
Gene alias: | Gem|RP3-369A17.3 |
Gene description: | geminin, DNA replication inhibitor |
Genbank accession: | BC005185 |
Immunogen: | GMNN (AAH05185, 110 a.a. ~ 209 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | LYEALKENEKLHKEIEQKDNEIARLKKENKELAEVAEHVQYMAELIERLNGEPLDNFESLDNQEFDSEEETVEDSLVEDSEIGTCAEGTVSSSTDAKPCI |
Protein accession: | AAH05185 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Shipping condition: | Dry Ice |