Brand: | Abnova |
Reference: | H00051053-M01 |
Product name: | GMNN monoclonal antibody (M01), clone 1A8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant GMNN. |
Clone: | 1A8 |
Isotype: | IgG1 Kappa |
Gene id: | 51053 |
Gene name: | GMNN |
Gene alias: | Gem|RP3-369A17.3 |
Gene description: | geminin, DNA replication inhibitor |
Genbank accession: | BC005185 |
Immunogen: | GMNN (AAH05185, 110 a.a. ~ 209 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | LYEALKENEKLHKEIEQKDNEIARLKKENKELAEVAEHVQYMAELIERLNGEPLDNFESLDNQEFDSEEETVEDSLVEDSEIGTCAEGTVSSSTDAKPCI |
Protein accession: | AAH05185 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoperoxidase of monoclonal antibody to GMNN on formalin-fixed paraffin-embedded human placenta. [antibody concentration 1 ug/ml] |
Applications: | IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |
Publications: | The BRCA1-Î11q Alternative Splice Isoform Bypasses Germline Mutations and Promotes Therapeutic Resistance to PARP Inhibition and CisplatinWang Y, Bernhardy AJ, Cruz C, Krais JJ, Nacson J, Nicolas E, Peri S, van der Gulden H, van der Hejiden I, O'Brien SW, Zhang Y, Harrell MI, Johnson SF, Candido Dos Reis FJ, Pharoah PD, Karlan B, Gourley C, Lambrechts D, Chenevix-Trench G, Olsson H, Benitez JJ, Greene MH, Gore M, Nussbaum R, Sadetzki S, Gayther SA, Kjaer SK, D'Andrea AD, Shapiro GI, Wiest DL, Connolly DC, Daly MB, Swisher EM, Bouwman P, Jonkers J, Balmana J, Serra V, Johnson N. Cancer Res. 2016 May 15. [Epub ahead of print] |