GMNN monoclonal antibody (M01), clone 1A8 View larger

GMNN monoclonal antibody (M01), clone 1A8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GMNN monoclonal antibody (M01), clone 1A8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr

More info about GMNN monoclonal antibody (M01), clone 1A8

Brand: Abnova
Reference: H00051053-M01
Product name: GMNN monoclonal antibody (M01), clone 1A8
Product description: Mouse monoclonal antibody raised against a partial recombinant GMNN.
Clone: 1A8
Isotype: IgG1 Kappa
Gene id: 51053
Gene name: GMNN
Gene alias: Gem|RP3-369A17.3
Gene description: geminin, DNA replication inhibitor
Genbank accession: BC005185
Immunogen: GMNN (AAH05185, 110 a.a. ~ 209 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: LYEALKENEKLHKEIEQKDNEIARLKKENKELAEVAEHVQYMAELIERLNGEPLDNFESLDNQEFDSEEETVEDSLVEDSEIGTCAEGTVSSSTDAKPCI
Protein accession: AAH05185
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00051053-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00051053-M01-3-41-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to GMNN on formalin-fixed paraffin-embedded human placenta. [antibody concentration 1 ug/ml]
Applications: IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice
Publications: The BRCA1-Δ11q Alternative Splice Isoform Bypasses Germline Mutations and Promotes Therapeutic Resistance to PARP Inhibition and CisplatinWang Y, Bernhardy AJ, Cruz C, Krais JJ, Nacson J, Nicolas E, Peri S, van der Gulden H, van der Hejiden I, O'Brien SW, Zhang Y, Harrell MI, Johnson SF, Candido Dos Reis FJ, Pharoah PD, Karlan B, Gourley C, Lambrechts D, Chenevix-Trench G, Olsson H, Benitez JJ, Greene MH, Gore M, Nussbaum R, Sadetzki S, Gayther SA, Kjaer SK, D'Andrea AD, Shapiro GI, Wiest DL, Connolly DC, Daly MB, Swisher EM, Bouwman P, Jonkers J, Balmana J, Serra V, Johnson N.
Cancer Res. 2016 May 15. [Epub ahead of print]

Reviews

Buy GMNN monoclonal antibody (M01), clone 1A8 now

Add to cart