PI15 monoclonal antibody (M02), clone 3B5 View larger

PI15 monoclonal antibody (M02), clone 3B5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PI15 monoclonal antibody (M02), clone 3B5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIHC-P,S-ELISA,ELISA,WB-Re

More info about PI15 monoclonal antibody (M02), clone 3B5

Brand: Abnova
Reference: H00051050-M02
Product name: PI15 monoclonal antibody (M02), clone 3B5
Product description: Mouse monoclonal antibody raised against a partial recombinant PI15.
Clone: 3B5
Isotype: IgG1 Kappa
Gene id: 51050
Gene name: PI15
Gene alias: CRISP8|DKFZp686F0366|P24TI|P25TI
Gene description: peptidase inhibitor 15
Genbank accession: NM_015886
Immunogen: PI15 (NP_056970, 18 a.a. ~ 117 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: EASTVVLLNSTDSSPPTNNFTDIEAALKAQLDSADIPKARRKRYISQNDMIAILDYHNQVRGKVFPPAANMEYMVWDENLAKSAEAWAATCIWDHGPSYL
Protein accession: NP_056970
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00051050-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00051050-M02-3-2-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to PI15 on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3 ug/ml]
Applications: IHC-P,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy PI15 monoclonal antibody (M02), clone 3B5 now

Add to cart