Brand: | Abnova |
Reference: | H00051050-M02 |
Product name: | PI15 monoclonal antibody (M02), clone 3B5 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant PI15. |
Clone: | 3B5 |
Isotype: | IgG1 Kappa |
Gene id: | 51050 |
Gene name: | PI15 |
Gene alias: | CRISP8|DKFZp686F0366|P24TI|P25TI |
Gene description: | peptidase inhibitor 15 |
Genbank accession: | NM_015886 |
Immunogen: | PI15 (NP_056970, 18 a.a. ~ 117 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | EASTVVLLNSTDSSPPTNNFTDIEAALKAQLDSADIPKARRKRYISQNDMIAILDYHNQVRGKVFPPAANMEYMVWDENLAKSAEAWAATCIWDHGPSYL |
Protein accession: | NP_056970 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoperoxidase of monoclonal antibody to PI15 on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3 ug/ml] |
Applications: | IHC-P,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |