Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Tr |
Brand: | Abnova |
Reference: | H00051050-B01P |
Product name: | PI15 purified MaxPab mouse polyclonal antibody (B01P) |
Product description: | Mouse polyclonal antibody raised against a full-length human PI15 protein. |
Gene id: | 51050 |
Gene name: | PI15 |
Gene alias: | CRISP8|DKFZp686F0366|P24TI|P25TI |
Gene description: | peptidase inhibitor 15 |
Genbank accession: | NM_015886.3 |
Immunogen: | PI15 (NP_056970.1, 1 a.a. ~ 258 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MIAISAVSSALLFSLLCEASTVVLLNSTDSSPPTNNFTDIEAALKAQLDSADIPKARRKRYISQNDMIAILDYHNQVRGKVFPPAANMEYMVWDENLAKSAEAWAATCIWDHGPSYLLRFLGQNLSVRTGRYRSILQLVKPWYDEVKDYAFPYPQDCNPRCPMRCFGPMCTHYTQMVWATSNRIGCAIHTCQNMNVWGSVWRRAVYLVCNYAPKGNWIGEAPYKVGVPCSSCPPSYGGSCTDNLCFPGVTSNYLYWFK |
Protein accession: | NP_056970.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of PI15 expression in transfected 293T cell line (H00051050-T01) by PI15 MaxPab polyclonal antibody. Lane 1: PI15 transfected lysate(28.38 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Tr |
Shipping condition: | Dry Ice |