Brand: | Abnova |
Reference: | H00051043-M03 |
Product name: | ZBTB7B monoclonal antibody (M03), clone 1D4 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ZBTB7B. |
Clone: | 1D4 |
Isotype: | IgG2a Kappa |
Gene id: | 51043 |
Gene name: | ZBTB7B |
Gene alias: | DKFZp686G01254|THPOK|ZBTB15|ZFP67|ZNF857B|c-Krox|hcKrox |
Gene description: | zinc finger and BTB domain containing 7B |
Genbank accession: | NM_015872 |
Immunogen: | ZBTB7B (NP_056956.1, 433 a.a. ~ 537 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | HLCHRAFAKEDHLQRHLKGQNCLEVRTRRRRKDDAPPHYPPPSTAAAFPAGLDLSNGHLDTFRLSLARFWEQSAPTWAPVSTPGPPDDDEEEGAPTTPQAEGAME |
Protein accession: | NP_056956.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.29 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged ZBTB7B is 0.03 ng/ml as a capture antibody. |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |