ZBTB7B monoclonal antibody (M03), clone 1D4 View larger

ZBTB7B monoclonal antibody (M03), clone 1D4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ZBTB7B monoclonal antibody (M03), clone 1D4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about ZBTB7B monoclonal antibody (M03), clone 1D4

Brand: Abnova
Reference: H00051043-M03
Product name: ZBTB7B monoclonal antibody (M03), clone 1D4
Product description: Mouse monoclonal antibody raised against a partial recombinant ZBTB7B.
Clone: 1D4
Isotype: IgG2a Kappa
Gene id: 51043
Gene name: ZBTB7B
Gene alias: DKFZp686G01254|THPOK|ZBTB15|ZFP67|ZNF857B|c-Krox|hcKrox
Gene description: zinc finger and BTB domain containing 7B
Genbank accession: NM_015872
Immunogen: ZBTB7B (NP_056956.1, 433 a.a. ~ 537 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: HLCHRAFAKEDHLQRHLKGQNCLEVRTRRRRKDDAPPHYPPPSTAAAFPAGLDLSNGHLDTFRLSLARFWEQSAPTWAPVSTPGPPDDDEEEGAPTTPQAEGAME
Protein accession: NP_056956.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00051043-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.29 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00051043-M03-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged ZBTB7B is 0.03 ng/ml as a capture antibody.
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ZBTB7B monoclonal antibody (M03), clone 1D4 now

Add to cart