Brand: | Abnova |
Reference: | H00051027-M07 |
Product name: | BOLA1 monoclonal antibody (M07), clone 2H3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant BOLA1. |
Clone: | 2H3 |
Isotype: | IgG1 Kappa |
Gene id: | 51027 |
Gene name: | BOLA1 |
Gene alias: | CGI-143|MGC75015|RP11-196G18.18 |
Gene description: | bolA homolog 1 (E. coli) |
Genbank accession: | NM_016074 |
Immunogen: | BOLA1 (NP_057158, 38 a.a. ~ 137 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | TKLEEALSPEVLELRNESGGHAVPPGSETHFRVAVVSSRFEGLSPLQRHRLVHAALAEELGGPVHALAIQARTPAQWRENSQLDTSPPCLGGNKKTLGTP |
Protein accession: | NP_057158 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |