BOLA1 monoclonal antibody (M07), clone 2H3 View larger

BOLA1 monoclonal antibody (M07), clone 2H3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of BOLA1 monoclonal antibody (M07), clone 2H3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about BOLA1 monoclonal antibody (M07), clone 2H3

Brand: Abnova
Reference: H00051027-M07
Product name: BOLA1 monoclonal antibody (M07), clone 2H3
Product description: Mouse monoclonal antibody raised against a partial recombinant BOLA1.
Clone: 2H3
Isotype: IgG1 Kappa
Gene id: 51027
Gene name: BOLA1
Gene alias: CGI-143|MGC75015|RP11-196G18.18
Gene description: bolA homolog 1 (E. coli)
Genbank accession: NM_016074
Immunogen: BOLA1 (NP_057158, 38 a.a. ~ 137 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: TKLEEALSPEVLELRNESGGHAVPPGSETHFRVAVVSSRFEGLSPLQRHRLVHAALAEELGGPVHALAIQARTPAQWRENSQLDTSPPCLGGNKKTLGTP
Protein accession: NP_057158
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00051027-M07-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy BOLA1 monoclonal antibody (M07), clone 2H3 now

Add to cart