FIS1 monoclonal antibody (M02), clone 3G6 View larger

FIS1 monoclonal antibody (M02), clone 3G6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FIS1 monoclonal antibody (M02), clone 3G6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about FIS1 monoclonal antibody (M02), clone 3G6

Brand: Abnova
Reference: H00051024-M02
Product name: FIS1 monoclonal antibody (M02), clone 3G6
Product description: Mouse monoclonal antibody raised against a full-length recombinant FIS1.
Clone: 3G6
Isotype: IgG2b Kappa
Gene id: 51024
Gene name: FIS1
Gene alias: CGI-135|TTC11
Gene description: fission 1 (mitochondrial outer membrane) homolog (S. cerevisiae)
Genbank accession: BC003540
Immunogen: FIS1 (AAH03540.1, 1 a.a. ~ 152 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEELLPKGSKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKDGLVGMAIVGGMALGVAGLAGLIGLAVSKSKS
Protein accession: AAH03540.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00051024-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (42.46 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00051024-M02-1-7-1.jpg
Application image note: FIS1 monoclonal antibody (M02), clone 3G6. Western Blot analysis of FIS1 expression in MCF-7 ( Cat # L046V1 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy FIS1 monoclonal antibody (M02), clone 3G6 now

Add to cart