Brand: | Abnova |
Reference: | H00051024-M01 |
Product name: | FIS1 monoclonal antibody (M01), clone 1G9 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant FIS1. |
Clone: | 1G9 |
Isotype: | IgG2b Kappa |
Gene id: | 51024 |
Gene name: | FIS1 |
Gene alias: | CGI-135|TTC11 |
Gene description: | fission 1 (mitochondrial outer membrane) homolog (S. cerevisiae) |
Genbank accession: | BC003540 |
Immunogen: | FIS1 (AAH03540.1, 1 a.a. ~ 152 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEELLPKGSKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKDGLVGMAIVGGMALGVAGLAGLIGLAVSKSKS |
Protein accession: | AAH03540.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (42.46 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoperoxidase of monoclonal antibody to FIS1 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml] |
Applications: | WB-Ce,WB-Ti,IHC-P,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |