FIS1 monoclonal antibody (M01), clone 1G9 View larger

FIS1 monoclonal antibody (M01), clone 1G9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FIS1 monoclonal antibody (M01), clone 1G9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,WB-Ti,IHC-P,S-ELISA,ELISA,WB-Re

More info about FIS1 monoclonal antibody (M01), clone 1G9

Brand: Abnova
Reference: H00051024-M01
Product name: FIS1 monoclonal antibody (M01), clone 1G9
Product description: Mouse monoclonal antibody raised against a full length recombinant FIS1.
Clone: 1G9
Isotype: IgG2b Kappa
Gene id: 51024
Gene name: FIS1
Gene alias: CGI-135|TTC11
Gene description: fission 1 (mitochondrial outer membrane) homolog (S. cerevisiae)
Genbank accession: BC003540
Immunogen: FIS1 (AAH03540.1, 1 a.a. ~ 152 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEELLPKGSKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKDGLVGMAIVGGMALGVAGLAGLIGLAVSKSKS
Protein accession: AAH03540.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00051024-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (42.46 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00051024-M01-3-36-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to FIS1 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml]
Applications: WB-Ce,WB-Ti,IHC-P,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy FIS1 monoclonal antibody (M01), clone 1G9 now

Add to cart