GLRX2 monoclonal antibody (M03), clone 3E9 View larger

GLRX2 monoclonal antibody (M03), clone 3E9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GLRX2 monoclonal antibody (M03), clone 3E9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about GLRX2 monoclonal antibody (M03), clone 3E9

Brand: Abnova
Reference: H00051022-M03
Product name: GLRX2 monoclonal antibody (M03), clone 3E9
Product description: Mouse monoclonal antibody raised against a full-length recombinant GLRX2.
Clone: 3E9
Isotype: IgG2a Kappa
Gene id: 51022
Gene name: GLRX2
Gene alias: GRX2|bA101E13.1
Gene description: glutaredoxin 2
Genbank accession: BC028113
Immunogen: GLRX2 (AAH28113, 1 a.a. ~ 124 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MESNTSSSLENLATAPVNQIQETISDNCVVIFSKTSCSYCTMAKKLFHDMNVNYKVVELDLLEYGNQFQDALYKMTGERTVPRIFVNGTFIGGATDTHRLHKEGKLLPLVHQCYLKKSKRKEFQ
Protein accession: AAH28113
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00051022-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (39.38 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00051022-M03-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged GLRX2 is 0.1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy GLRX2 monoclonal antibody (M03), clone 3E9 now

Add to cart