GLRX2 purified MaxPab mouse polyclonal antibody (B02P) View larger

GLRX2 purified MaxPab mouse polyclonal antibody (B02P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GLRX2 purified MaxPab mouse polyclonal antibody (B02P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about GLRX2 purified MaxPab mouse polyclonal antibody (B02P)

Brand: Abnova
Reference: H00051022-B02P
Product name: GLRX2 purified MaxPab mouse polyclonal antibody (B02P)
Product description: Mouse polyclonal antibody raised against a full-length human GLRX2 protein.
Gene id: 51022
Gene name: GLRX2
Gene alias: GRX2|bA101E13.1
Gene description: glutaredoxin 2
Genbank accession: NM_197962
Immunogen: GLRX2 (NP_932066.1, 1 a.a. ~ 164 a.a) full-length human protein.
Immunogen sequence/protein sequence: MIWRRAALAGTRLVWSRSGSAGWLDRAAGAAGAAAAAASGMESNTSSSLENLATAPVNQIQETISDNCVVIFSKTSCSYCTMAKKLFHDMNVNYKVVELDLLEYGNQFQDALYKMTGERTVPRIFVNGTFIGGATDTHRLHKEGKLLPLVHQCYLKKSKRKEFQ
Protein accession: NP_932066.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00051022-B02P-13-15-1.jpg
Application image note: Western Blot analysis of GLRX2 expression in transfected 293T cell line (H00051022-T02) by GLRX2 MaxPab polyclonal antibody.

Lane 1: GLRX2 transfected lysate(18.04 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy GLRX2 purified MaxPab mouse polyclonal antibody (B02P) now

Add to cart