Brand: | Abnova |
Reference: | H00051010-M11 |
Product name: | EXOSC3 monoclonal antibody (M11), clone 3E5 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant EXOSC3. |
Clone: | 3E5 |
Isotype: | IgG2a Kappa |
Gene id: | 51010 |
Gene name: | EXOSC3 |
Gene alias: | CGI-102|MGC15120|MGC723|RP11-3J10.8|RRP40|Rrp40p|bA3J10.7|hRrp40p|p10 |
Gene description: | exosome component 3 |
Genbank accession: | NM_016042 |
Immunogen: | EXOSC3 (NP_057126.2, 176 a.a. ~ 274 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | PEMVCIDSCGRANGMGVIGQDGLLFKVTLGLIRKLLAPDCEIIQEVGKLYPLEIVFGMNGRIWVKAKTIQQTLILANILEACEHMTSDQRKQIFSRLAE |
Protein accession: | NP_057126.2 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged EXOSC3 is 0.1 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,IP |
Shipping condition: | Dry Ice |