EXOSC3 monoclonal antibody (M11), clone 3E5 View larger

EXOSC3 monoclonal antibody (M11), clone 3E5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of EXOSC3 monoclonal antibody (M11), clone 3E5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,IP

More info about EXOSC3 monoclonal antibody (M11), clone 3E5

Brand: Abnova
Reference: H00051010-M11
Product name: EXOSC3 monoclonal antibody (M11), clone 3E5
Product description: Mouse monoclonal antibody raised against a partial recombinant EXOSC3.
Clone: 3E5
Isotype: IgG2a Kappa
Gene id: 51010
Gene name: EXOSC3
Gene alias: CGI-102|MGC15120|MGC723|RP11-3J10.8|RRP40|Rrp40p|bA3J10.7|hRrp40p|p10
Gene description: exosome component 3
Genbank accession: NM_016042
Immunogen: EXOSC3 (NP_057126.2, 176 a.a. ~ 274 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: PEMVCIDSCGRANGMGVIGQDGLLFKVTLGLIRKLLAPDCEIIQEVGKLYPLEIVFGMNGRIWVKAKTIQQTLILANILEACEHMTSDQRKQIFSRLAE
Protein accession: NP_057126.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00051010-M11-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged EXOSC3 is 0.1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,IP
Shipping condition: Dry Ice

Reviews

Buy EXOSC3 monoclonal antibody (M11), clone 3E5 now

Add to cart