EXOSC3 monoclonal antibody (M03), clone 5C3 View larger

EXOSC3 monoclonal antibody (M03), clone 5C3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of EXOSC3 monoclonal antibody (M03), clone 5C3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr,IP

More info about EXOSC3 monoclonal antibody (M03), clone 5C3

Brand: Abnova
Reference: H00051010-M03
Product name: EXOSC3 monoclonal antibody (M03), clone 5C3
Product description: Mouse monoclonal antibody raised against a full length recombinant EXOSC3.
Clone: 5C3
Isotype: IgG2a Kappa
Gene id: 51010
Gene name: EXOSC3
Gene alias: CGI-102|MGC15120|MGC723|RP11-3J10.8|RRP40|Rrp40p|bA3J10.7|hRrp40p|p10
Gene description: exosome component 3
Genbank accession: BC002437
Immunogen: EXOSC3 (AAH02437, 1 a.a. ~ 275 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MAEPASVAAESLAGSRARAARTVLGQVVLPGEELLLPEQEDAEGPGGAVERPLSLNARACSRVRVVCGPGLRRCGDRLLVTKCGRLRHKEPGSGSGGGVYWVDSQQKRYVPVKGDHVIGIVTAKSGDIFKVDVGGSEPASLSYLSFEGATKRNRPNVQVGDLIYGQFVVANKDMEPEMVCIDSCGRANGMGVIGQDGLLFKVTLGLIRKLLAPDCEIIQEVGKLYPLEIVFGMNGRIWVKAKTIQQTLILANILEACEHMTSDQRKQIFSRLAES
Protein accession: AAH02437
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00051010-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (55.99 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00051010-M03-3-2-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to EXOSC3 on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3 ug/ml]
Applications: WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr,IP
Shipping condition: Dry Ice

Reviews

Buy EXOSC3 monoclonal antibody (M03), clone 5C3 now

Add to cart