Brand: | Abnova |
Reference: | H00051003-M01 |
Product name: | MED31 monoclonal antibody (M01), clone 2C8 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant MED31. |
Clone: | 2C8 |
Isotype: | IgG2b Kappa |
Gene id: | 51003 |
Gene name: | MED31 |
Gene alias: | 3110004H13Rik|CGI-125|FLJ27436|FLJ36714|Soh1 |
Gene description: | mediator complex subunit 31 |
Genbank accession: | BC012539 |
Immunogen: | MED31 (AAH12539, 1 a.a. ~ 131 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MAAAVAMETDDAGNRLRFQLELEFVQCLANPNYLNFLAQRGYFKDKAFVNYLKYLLYWKDPEYAKYLKYPQCLHMLELLQYEHFRKELVNAQCAKFIDEQQILHWQHYSRKRMRLQQALAEQQQQNNTSGK |
Protein accession: | AAH12539 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![qc_test-H00051003-M01-1.jpg](http://www.abnova.com/qc_test_image/qc_test-H00051003-M01-1.jpg) |
Quality control testing picture note: | Western Blot detection against Immunogen (40.15 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![H00051003-M01-3-41-1-L.jpg](http://www.abnova.com/application_image/H00051003-M01-3-41-1-L.jpg) |
Application image note: | Immunoperoxidase of monoclonal antibody to MED31 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml] |
Applications: | WB-Ce,IHC-P,IF,ELISA,WB-Re |
Shipping condition: | Dry Ice |