CGI-121 monoclonal antibody (M01), clone 3F6 View larger

CGI-121 monoclonal antibody (M01), clone 3F6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CGI-121 monoclonal antibody (M01), clone 3F6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about CGI-121 monoclonal antibody (M01), clone 3F6

Brand: Abnova
Reference: H00051002-M01
Product name: CGI-121 monoclonal antibody (M01), clone 3F6
Product description: Mouse monoclonal antibody raised against a partial recombinant CGI-121.
Clone: 3F6
Isotype: IgG1 Kappa
Gene id: 51002
Gene name: TPRKB
Gene alias: CGI-121
Gene description: TP53RK binding protein
Genbank accession: NM_016058
Immunogen: CGI-121 (NP_057142, 66 a.a. ~ 175 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: KLGKMKTRTLSTEIIFNLSPNNNISEALKKFGISANDTSILIVYIEEGEKQINQEYLISQVEGHQVSLKNLPEIMNITEVKKIYKLSSQEESIGTLLDAIICRMSTKDVL
Protein accession: NP_057142
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00051002-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00051002-M01-13-15-1.jpg
Application image note: Western Blot analysis of TPRKB expression in transfected 293T cell line by CGI-121 monoclonal antibody (M01), clone 3F6.

Lane 1: TPRKB transfected lysate(19.7 KDa).
Lane 2: Non-transfected lysate.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy CGI-121 monoclonal antibody (M01), clone 3F6 now

Add to cart