Brand: | Abnova |
Reference: | H00050944-M01 |
Product name: | SHANK1 monoclonal antibody (M01), clone 8F7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant SHANK1. |
Clone: | 8F7 |
Isotype: | IgG2a Kappa |
Gene id: | 50944 |
Gene name: | SHANK1 |
Gene alias: | SPANK-1|SSTRIP|synamon |
Gene description: | SH3 and multiple ankyrin repeat domains 1 |
Genbank accession: | NM_016148.2 |
Immunogen: | SHANK1 (NP_057232.2, 2088 a.a. ~ 2161 a.a) partial recombinant protein with GST-pstS1 tag. |
Immunogen sequence/protein sequence: | KPFGAKPLGFWTKFDVADWLEWLGLAEHRAQFLDHEIDGSHLPALTKEDYVDLGVTRVGHRMNIDRALKFFLER |
Protein accession: | NP_057232.2 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![qc_test-H00050944-M01-1.jpg](http://www.abnova.com/qc_test_image/qc_test-H00050944-M01-1.jpg) |
Quality control testing picture note: | Western Blot detection against Immunogen (36.08 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![H00050944-M01-9-22-1.jpg](http://www.abnova.com/application_image/H00050944-M01-9-22-1.jpg) |
Application image note: | Detection limit for recombinant GST tagged SHANK1 is 0.03 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |