IMPG2 monoclonal antibody (M02), clone 3H5 View larger

IMPG2 monoclonal antibody (M02), clone 3H5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of IMPG2 monoclonal antibody (M02), clone 3H5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about IMPG2 monoclonal antibody (M02), clone 3H5

Brand: Abnova
Reference: H00050939-M02
Product name: IMPG2 monoclonal antibody (M02), clone 3H5
Product description: Mouse monoclonal antibody raised against a partial recombinant IMPG2.
Clone: 3H5
Isotype: IgG2a Kappa
Gene id: 50939
Gene name: IMPG2
Gene alias: IPM200|SPACRCAN
Gene description: interphotoreceptor matrix proteoglycan 2
Genbank accession: NM_016247
Immunogen: IMPG2 (NP_057331.2, 572 a.a. ~ 678 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: LTSKVKDQLKVSPFLPDASMEKELIFDGGLGSGSGQKVDLITWPWSETSSEKSAEPLSKPWLEDDDSLLPAEIEDKKLVLVDKMDSTDQISKHSKYEHDDRSTHFPE
Protein accession: NP_057331.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00050939-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.51 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00050939-M02-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged IMPG2 is 0.03 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy IMPG2 monoclonal antibody (M02), clone 3H5 now

Add to cart