CDON monoclonal antibody (M03), clone 2G12 View larger

CDON monoclonal antibody (M03), clone 2G12

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CDON monoclonal antibody (M03), clone 2G12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about CDON monoclonal antibody (M03), clone 2G12

Brand: Abnova
Reference: H00050937-M03
Product name: CDON monoclonal antibody (M03), clone 2G12
Product description: Mouse monoclonal antibody raised against a partial recombinant CDON.
Clone: 2G12
Isotype: IgG2a Kappa
Gene id: 50937
Gene name: CDON
Gene alias: CDO|MGC111524|ORCAM
Gene description: Cdon homolog (mouse)
Genbank accession: NM_016952
Immunogen: CDON (NP_058648, 1155 a.a. ~ 1263 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: VKVPVCLTSAVPDCGQLPEESVKDNVEPVPTQRTCCQDIVNDVSSDGSEDPAEFSRGDSCAHSETEINIVSWNALILPPVPEGCAEKTMWSPPGIPLDSPTEVLQQPRE
Protein accession: NP_058648
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00050937-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.73 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy CDON monoclonal antibody (M03), clone 2G12 now

Add to cart