Brand: | Abnova |
Reference: | H00050937-M03 |
Product name: | CDON monoclonal antibody (M03), clone 2G12 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CDON. |
Clone: | 2G12 |
Isotype: | IgG2a Kappa |
Gene id: | 50937 |
Gene name: | CDON |
Gene alias: | CDO|MGC111524|ORCAM |
Gene description: | Cdon homolog (mouse) |
Genbank accession: | NM_016952 |
Immunogen: | CDON (NP_058648, 1155 a.a. ~ 1263 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | VKVPVCLTSAVPDCGQLPEESVKDNVEPVPTQRTCCQDIVNDVSSDGSEDPAEFSRGDSCAHSETEINIVSWNALILPPVPEGCAEKTMWSPPGIPLDSPTEVLQQPRE |
Protein accession: | NP_058648 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.73 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |