HEBP1 monoclonal antibody (M01), clone 1A4 View larger

HEBP1 monoclonal antibody (M01), clone 1A4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HEBP1 monoclonal antibody (M01), clone 1A4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA

More info about HEBP1 monoclonal antibody (M01), clone 1A4

Brand: Abnova
Reference: H00050865-M01
Product name: HEBP1 monoclonal antibody (M01), clone 1A4
Product description: Mouse monoclonal antibody raised against a partial recombinant HEBP1.
Clone: 1A4
Isotype: IgG2b Kappa
Gene id: 50865
Gene name: HEBP1
Gene alias: HBP|HEBP
Gene description: heme binding protein 1
Genbank accession: NM_015987.2
Immunogen: HEBP1 (NP_057071.2, 80 a.a. ~ 189 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: VPISFAVFPNEDGSLQKKLKVWFRIPNQFQSDPPAPSDKSVKIEEREGITVYSMQFGGYAKEADYVAQATRLRAALEGTATYRGDIYFCTGYDPPMKPYGRRNEIWLLKT
Protein accession: NP_057071.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA
Shipping condition: Dry Ice

Reviews

Buy HEBP1 monoclonal antibody (M01), clone 1A4 now

Add to cart