HEBP1 purified MaxPab mouse polyclonal antibody (B02P) View larger

HEBP1 purified MaxPab mouse polyclonal antibody (B02P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HEBP1 purified MaxPab mouse polyclonal antibody (B02P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about HEBP1 purified MaxPab mouse polyclonal antibody (B02P)

Brand: Abnova
Reference: H00050865-B02P
Product name: HEBP1 purified MaxPab mouse polyclonal antibody (B02P)
Product description: Mouse polyclonal antibody raised against a full-length human HEBP1 protein.
Gene id: 50865
Gene name: HEBP1
Gene alias: HBP|HEBP
Gene description: heme binding protein 1
Genbank accession: NM_015987.3
Immunogen: HEBP1 (AAH16277.1, 1 a.a. ~ 189 a.a) full-length human protein.
Immunogen sequence/protein sequence: MLGMIKNSLFGSVETWPWQVLSKGDKEEVAYEERACEGGKFATVEVTDKPVDEALREAMPKVAKYAGGTNDKGIGMGMTVPISFAVFPNEDGSLQKKLKVWFRIPNQFQSDPPAPSDKSVKIEEREGITVYSMQFGGYAKEADYVAQATRLRAALEGTATYRGDIYFCTGYDPPMKPYGRRNEIWLLKT
Protein accession: AAH16277.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00050865-B02P-13-15-1.jpg
Application image note: Western Blot analysis of HEBP1 expression in transfected 293T cell line (H00050865-T02) by HEBP1 MaxPab polyclonal antibody.

Lane 1: HEBP1 transfected lysate(20.79 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy HEBP1 purified MaxPab mouse polyclonal antibody (B02P) now

Add to cart