Brand: | Abnova |
Reference: | H00050862-M01 |
Product name: | RNF141 monoclonal antibody (M01), clone 6D9 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant RNF141. |
Clone: | 6D9 |
Isotype: | IgG1 Kappa |
Gene id: | 50862 |
Gene name: | RNF141 |
Gene alias: | MGC8715|ZFP26|ZNF230 |
Gene description: | ring finger protein 141 |
Genbank accession: | NM_016422 |
Immunogen: | RNF141 (NP_001008563, 141 a.a. ~ 229 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | LWMGRVKQLTDEEECCICMDGRADLILPCAHSFCQKCIDKWSDRHRNCPICRLQMTGANESWVVSDAPTEDDMANYILNMADEAGQPHR |
Protein accession: | NP_001008563 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (35.53 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse,Rat |
Application image: |  |
Application image note: | Immunoperoxidase of monoclonal antibody to RNF141 on formalin-fixed paraffin-embedded human testis. [antibody concentration 0.3 ug/ml] |
Applications: | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab |
Shipping condition: | Dry Ice |