Brand: | Abnova |
Reference: | H00050859-M01 |
Product name: | SPOCK3 monoclonal antibody (M01), clone 1A10 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant SPOCK3. |
Clone: | 1A10 |
Isotype: | IgG2b Kappa |
Gene id: | 50859 |
Gene name: | SPOCK3 |
Gene alias: | HSAJ1454|TES-3 |
Gene description: | sparc/osteonectin, cwcv and kazal-like domains proteoglycan (testican) 3 |
Genbank accession: | NM_016950 |
Immunogen: | SPOCK3 (NP_058646, 132 a.a. ~ 230 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | RGPILSTCKQCPVVYPSPVCGSDGHTYSFQCKLEYQACVLGKQISVKCEGHCPCPSDKPTSTSRNVKRACSDLEFREVANRLRDWFKALHESGSQNKKT |
Protein accession: | NP_058646 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![H00050859-M01-9-19-1.jpg](http://www.abnova.com/application_image/H00050859-M01-9-19-1.jpg) |
Application image note: | Detection limit for recombinant GST tagged SPOCK3 is 1 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA |
Shipping condition: | Dry Ice |