PARD6A polyclonal antibody (A01) View larger

PARD6A polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PARD6A polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about PARD6A polyclonal antibody (A01)

Brand: Abnova
Reference: H00050855-A01
Product name: PARD6A polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant PARD6A.
Gene id: 50855
Gene name: PARD6A
Gene alias: PAR-6A|PAR6|PAR6C|PAR6alpha|TAX40|TIP-40
Gene description: par-6 partitioning defective 6 homolog alpha (C. elegans)
Genbank accession: NM_016948
Immunogen: PARD6A (NP_058644, 247 a.a. ~ 346 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: KPANQRNNVVRGASGRLTGPPSAGPGPAEPDSDDDSSDLVIENRQPPSSNGLSQGPPCWDLHPGCRHPGTRSSLPSLDDQGQASSGWGSRIRGDGSGFSL
Protein accession: NP_058644
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00050855-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.11 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00050855-A01-1-6-1.jpg
Application image note: PARD6A polyclonal antibody (A01), Lot # SIM4060302QCS1 Western Blot analysis of PARD6A expression in Jurkat ( Cat # L017V1 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy PARD6A polyclonal antibody (A01) now

Add to cart