Brand: | Abnova |
Reference: | H00050846-M07 |
Product name: | DHH monoclonal antibody (M07), clone 2G5 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant DHH. |
Clone: | 2G5 |
Isotype: | IgG2a Kappa |
Gene id: | 50846 |
Gene name: | DHH |
Gene alias: | HHG-3|MGC35145 |
Gene description: | desert hedgehog homolog (Drosophila) |
Genbank accession: | NM_021044 |
Immunogen: | DHH (NP_066382, 210 a.a. ~ 310 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | SGERKGLRELHRGDWVLAADASGRVVPTPVLLFLDRDLQRRASFVAVETEWPPRKLLLTPWHLVFAARGPAPAPGDFAPVFARRLRAGDSVLAPGGDALRP* |
Protein accession: | NP_066382 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | DHH monoclonal antibody (M07), clone 2G5. Western Blot analysis of DHH expression in human colon. |
Applications: | WB-Ti,ELISA |
Shipping condition: | Dry Ice |