DHH monoclonal antibody (M06), clone 3G10 View larger

DHH monoclonal antibody (M06), clone 3G10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DHH monoclonal antibody (M06), clone 3G10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,ELISA

More info about DHH monoclonal antibody (M06), clone 3G10

Brand: Abnova
Reference: H00050846-M06
Product name: DHH monoclonal antibody (M06), clone 3G10
Product description: Mouse monoclonal antibody raised against a partial recombinant DHH.
Clone: 3G10
Isotype: IgG2a Kappa
Gene id: 50846
Gene name: DHH
Gene alias: HHG-3|MGC35145
Gene description: desert hedgehog homolog (Drosophila)
Genbank accession: NM_021044
Immunogen: DHH (NP_066382, 210 a.a. ~ 310 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: SGERKGLRELHRGDWVLAADASGRVVPTPVLLFLDRDLQRRASFVAVETEWPPRKLLLTPWHLVFAARGPAPAPGDFAPVFARRLRAGDSVLAPGGDALRP*
Protein accession: NP_066382
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00050846-M06-2-A2-1.jpg
Application image note: DHH monoclonal antibody (M06), clone 3G10. Western Blot analysis of DHH expression in human colon.
Applications: WB-Ti,ELISA
Shipping condition: Dry Ice

Reviews

Buy DHH monoclonal antibody (M06), clone 3G10 now

Add to cart