TAS2R16 (Human) Recombinant Protein View larger

TAS2R16 (Human) Recombinant Protein

H00050833-G01_2ug

New product

374,00 € tax excl.

2 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TAS2R16 (Human) Recombinant Protein

BrandAbnova
Product typeProteins
Host speciesWheat Germ (in vitro)
ApplicationsAP

More info about TAS2R16 (Human) Recombinant Protein

Brand: Abnova
Reference: H00050833-G01
Product name: TAS2R16 (Human) Recombinant Protein
Product description: Human TAS2R16 full-length ORF (NP_058641.1) recombinant protein without tag.
Gene id: 50833
Gene name: TAS2R16
Gene alias: T2R16
Gene description: taste receptor, type 2, member 16
Genbank accession: NM_016945.2
Immunogen sequence/protein sequence: MIPIQLTVFFMIIYVLESLTIIVQSSLIVAVLGREWLQVRRLMPVDMILISLGISRFCLQWASMLNNFCSYFNLNYVLCNLTITWEFFNILTFWLNSLLTVFYCIKVSSFTHHIFLWLRWRILRLFPWILLGSLMITCVTIIPSAIGNYIQIQLLTMEHLPRNSTVTDKLENFHQYQFQAHTVALVIPFILFLASTIFLMASLTKQIQHHSTGHCNPSMKARFTALRSLAVLFIVFTSYFLTILITIIGTLFDKRCWLWVWEAFVYAFILMHSTSLMLSSPTLKRILKGKC
Protein accession: NP_058641.1
Form: Liquid
Preparation method: in vitro wheat germ expression system with proprietary liposome technology
Recommend dilutions: Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Storage buffer: 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Storage instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note: Best use within three months from the date of receipt of this protein.
Tag: None
Product type: Proteins
Host species: Wheat Germ (in vitro)
Antigen species / target species: Human
Applications: AP
Shipping condition: Dry Ice

Reviews

Buy TAS2R16 (Human) Recombinant Protein now

Add to cart