AK3 purified MaxPab rabbit polyclonal antibody (D01P) View larger

AK3 purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of AK3 purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Ce,WB-Tr

More info about AK3 purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00050808-D01P
Product name: AK3 purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human AK3 protein.
Gene id: 50808
Gene name: AK3
Gene alias: AK3L1|AK6|AKL3L|AKL3L1|FIX
Gene description: adenylate kinase 3
Genbank accession: NM_016282.2
Immunogen: AK3 (NP_057366.2, 1 a.a. ~ 227 a.a) full-length human protein.
Immunogen sequence/protein sequence: MGASARLLRAVIMGAPGSGKGTVSSRITTHFELKHLSSGDLLRDNMLRGTEIGVLAKAFIDQGKLIPDDVMTRLALHELKNLTQYSWLLDGFPRTLPQAEALDRAYQIDTVINLNVPFEVIKQRLTARWIHPASGRVYNIEFNPPKTVGIDDLTGEPLIQREDDKPETVIKRLKAYEDQTKPVLEYYQKKGVLETFSGTETNKIWPYVYAFLQTKVPQRSQKASVTP
Protein accession: NP_057366.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00050808-D01P-13-15-1.jpg
Application image note: Western Blot analysis of AK3 expression in transfected 293T cell line (H00050808-T01) by AK3 MaxPab polyclonal antibody.

Lane 1: AK3 transfected lysate(25.60 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ce,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy AK3 purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart