DDEF1 monoclonal antibody (M01), clone 2G7 View larger

DDEF1 monoclonal antibody (M01), clone 2G7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DDEF1 monoclonal antibody (M01), clone 2G7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Rat
Host speciesMouse
ApplicationsWB-Ce,IF,S-ELISA,ELISA,WB-Re

More info about DDEF1 monoclonal antibody (M01), clone 2G7

Brand: Abnova
Reference: H00050807-M01
Product name: DDEF1 monoclonal antibody (M01), clone 2G7
Product description: Mouse monoclonal antibody raised against a partial recombinant DDEF1.
Clone: 2G7
Isotype: IgG2a Kappa
Gene id: 50807
Gene name: ASAP1
Gene alias: AMAP1|CENTB4|DDEF1|KIAA1249|PAG2|PAP|ZG14P
Gene description: ArfGAP with SH3 domain, ankyrin repeat and PH domain 1
Genbank accession: NM_018482
Immunogen: DDEF1 (NP_060952, 1030 a.a. ~ 1129 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: VQSRDAIQKQASEDSNDLTPTLPETPVPLPRKINTGKNKVRRVKTIYDCQADNDDELTFIEGEVIIVTGEEDQEWWIGHIEGQPERKGVFPVSFVHILSD
Protein accession: NP_060952
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00050807-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Rat
Application image: H00050807-M01-4-1-1-L.jpg
Application image note: Immunofluorescence of monoclonal antibody to DDEF1 on HeLa cell. [antibody concentration 10 ug/ml]
Applications: WB-Ce,IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy DDEF1 monoclonal antibody (M01), clone 2G7 now

Add to cart