Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of ARHGEF3 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA |
More info about ARHGEF3 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00050650-A01 |
| Product name: | ARHGEF3 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant ARHGEF3. |
| Gene id: | 50650 |
| Gene name: | ARHGEF3 |
| Gene alias: | DKFZp434F2429|FLJ98126|GEF3|MGC118905|STA3|XPLN |
| Gene description: | Rho guanine nucleotide exchange factor (GEF) 3 |
| Genbank accession: | NM_019555 |
| Immunogen: | ARHGEF3 (NP_062455, 33 a.a. ~ 142 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | EPSNKRVKPLSRVTSLANLIPPVKATPLKRFSQTLQRSISFRSESRPDILAPRPWSRNAAPSSTKRRDSKLWSETFDVCVNQMLTSKEIKRQEAIFELSQGEEDLIEDLK |
| Protein accession: | NP_062455 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |
| Publications: | ARHGEF3 controls HDACi-induced differentiation via RhoA-dependent pathways in acute myeloid leukemias.D'Amato L, Dell'Aversana C, Conte M, Ciotta A, Scisciola L, Carissimo A, Nebbioso A, Altucci L. Epigenetics. 2014 Dec 12:0. |