GEMIN4 monoclonal antibody (M01), clone 3E1 View larger

GEMIN4 monoclonal antibody (M01), clone 3E1

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GEMIN4 monoclonal antibody (M01), clone 3E1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA,WB-Re

More info about GEMIN4 monoclonal antibody (M01), clone 3E1

Brand: Abnova
Reference: H00050628-M01
Product name: GEMIN4 monoclonal antibody (M01), clone 3E1
Product description: Mouse monoclonal antibody raised against a partial recombinant GEMIN4.
Clone: 3E1
Isotype: IgG2b Kappa
Gene id: 50628
Gene name: GEMIN4
Gene alias: DKFZp434B131|DKFZp434D174|HC56|HCAP1|HHRF-1|p97
Gene description: gem (nuclear organelle) associated protein 4
Genbank accession: NM_015721
Immunogen: GEMIN4 (NP_056536, 959 a.a. ~ 1057 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: AAGPWVQGPEQDLTQEALFVYTQVFCHALHIMAMLHPEVCEPLYVLALETLTCYETLSKTNPSVSSLLQRAHEQRFLKSIAEGIGPEERRQTLLQKMSS
Protein accession: NP_056536
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00050628-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00050628-M01-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged GEMIN4 is 1 ng/ml as a capture antibody.
Applications: IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy GEMIN4 monoclonal antibody (M01), clone 3E1 now

Add to cart