DEF6 monoclonal antibody (M01A), clone 1F2 View larger

DEF6 monoclonal antibody (M01A), clone 1F2

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DEF6 monoclonal antibody (M01A), clone 1F2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about DEF6 monoclonal antibody (M01A), clone 1F2

Brand: Abnova
Reference: H00050619-M01A
Product name: DEF6 monoclonal antibody (M01A), clone 1F2
Product description: Mouse monoclonal antibody raised against a full-length recombinant DEF6.
Clone: 1F2
Isotype: IgG2a Kappa
Gene id: 50619
Gene name: DEF6
Gene alias: IBP|SLAT
Gene description: differentially expressed in FDCP 6 homolog (mouse)
Genbank accession: BC017504
Immunogen: DEF6 (AAH17504, 1 a.a. ~ 336 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MALRKELLKSIWYAFTALDVEKSGKVSKSQLKVLSHNLYTVLHIPHDPVALEEHFRDDDDGPVSSQGYMPYLNKYILDKVEEGAFVKEHFDELCWTLTAKKNYRADSNGNSMLSNQDAFRLWCLFNFLSEDKYPLIMVPDEVEYLLKKVLSSMSLEVSLGELEELLAQEAQVAQTTGGLSVWQFLELFNSGRCLRGVGRDTLSMAIHEVYQELIQDVLKQGYLWKRGHLRRNWAERWFQLQPSCLCYFGSEECKEKRGIIPLDAHCCVEVLPDRDGKRCMFCVKTATRTYEMSASDTRQRQEWTAAIQMAIRLQAEGKTSLHKDLKQKRREQREQR
Protein accession: AAH17504
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00050619-M01A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (62.7 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy DEF6 monoclonal antibody (M01A), clone 1F2 now

Add to cart