Brand: | Abnova |
Reference: | H00050619-M01A |
Product name: | DEF6 monoclonal antibody (M01A), clone 1F2 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant DEF6. |
Clone: | 1F2 |
Isotype: | IgG2a Kappa |
Gene id: | 50619 |
Gene name: | DEF6 |
Gene alias: | IBP|SLAT |
Gene description: | differentially expressed in FDCP 6 homolog (mouse) |
Genbank accession: | BC017504 |
Immunogen: | DEF6 (AAH17504, 1 a.a. ~ 336 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MALRKELLKSIWYAFTALDVEKSGKVSKSQLKVLSHNLYTVLHIPHDPVALEEHFRDDDDGPVSSQGYMPYLNKYILDKVEEGAFVKEHFDELCWTLTAKKNYRADSNGNSMLSNQDAFRLWCLFNFLSEDKYPLIMVPDEVEYLLKKVLSSMSLEVSLGELEELLAQEAQVAQTTGGLSVWQFLELFNSGRCLRGVGRDTLSMAIHEVYQELIQDVLKQGYLWKRGHLRRNWAERWFQLQPSCLCYFGSEECKEKRGIIPLDAHCCVEVLPDRDGKRCMFCVKTATRTYEMSASDTRQRQEWTAAIQMAIRLQAEGKTSLHKDLKQKRREQREQR |
Protein accession: | AAH17504 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (62.7 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |