IL20 monoclonal antibody (M01), clone 2H8 View larger

IL20 monoclonal antibody (M01), clone 2H8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of IL20 monoclonal antibody (M01), clone 2H8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr,IP

More info about IL20 monoclonal antibody (M01), clone 2H8

Brand: Abnova
Reference: H00050604-M01
Product name: IL20 monoclonal antibody (M01), clone 2H8
Product description: Mouse monoclonal antibody raised against a partial recombinant IL20.
Clone: 2H8
Isotype: IgG1 Kappa
Gene id: 50604
Gene name: IL20
Gene alias: IL-20|IL10D|MGC96907|ZCYTO10
Gene description: interleukin 20
Genbank accession: NM_018724
Immunogen: IL20 (NP_061194, 67 a.a. ~ 176 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: RTESLQDTKPANRCCLLRHLLRLYLDRVFKNYQTPDHYTLRKISSLANSFLTIKKDLRLCHAHMTCHCGEEAMKKYSQILSHFEKLEPQAAVVKALGELDILLQWMEETE
Protein accession: NP_061194
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00050604-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00050604-M01-1-9-1.jpg
Application image note: IL20 monoclonal antibody (M01), clone 2H8 Western Blot analysis of IL20 expression in K-562 ( Cat # L009V1 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr,IP
Shipping condition: Dry Ice

Reviews

Buy IL20 monoclonal antibody (M01), clone 2H8 now

Add to cart