IL20 purified MaxPab mouse polyclonal antibody (B02P) View larger

IL20 purified MaxPab mouse polyclonal antibody (B02P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of IL20 purified MaxPab mouse polyclonal antibody (B02P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about IL20 purified MaxPab mouse polyclonal antibody (B02P)

Brand: Abnova
Reference: H00050604-B02P
Product name: IL20 purified MaxPab mouse polyclonal antibody (B02P)
Product description: Mouse polyclonal antibody raised against a full-length human IL20 protein.
Gene id: 50604
Gene name: IL20
Gene alias: IL-20|IL10D|MGC96907|ZCYTO10
Gene description: interleukin 20
Genbank accession: NM_018724.3
Immunogen: IL20 (NP_061194.2, 1 a.a. ~ 176 a.a) full-length human protein.
Immunogen sequence/protein sequence: MKASSLAFSLLSAAFYLLWTPSTGLKTLNLGSCVIATNLQEIRNGFSEIRGSVQAKDGNIDIRILRRTESLQDTKPANRCCLLRHLLRLYLDRVFKNYQTPDHYTLRKISSLANSFLTIKKDLRLCHAHMTCHCGEEAMKKYSQILSHFEKLEPQAAVVKALGELDILLQWMEETE
Protein accession: NP_061194.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00050604-B02P-13-15-1.jpg
Application image note: Western Blot analysis of IL20 expression in transfected 293T cell line (H00050604-T02) by IL20 MaxPab polyclonal antibody.

Lane 1: IL20 transfected lysate(19.36 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy IL20 purified MaxPab mouse polyclonal antibody (B02P) now

Add to cart