CHST11 monoclonal antibody (M02), clone 1H3 View larger

CHST11 monoclonal antibody (M02), clone 1H3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CHST11 monoclonal antibody (M02), clone 1H3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about CHST11 monoclonal antibody (M02), clone 1H3

Brand: Abnova
Reference: H00050515-M02
Product name: CHST11 monoclonal antibody (M02), clone 1H3
Product description: Mouse monoclonal antibody raised against a partial recombinant CHST11.
Clone: 1H3
Isotype: IgG2a Kappa
Gene id: 50515
Gene name: CHST11
Gene alias: C4ST|C4ST-1|C4ST1|HSA269537
Gene description: carbohydrate (chondroitin 4) sulfotransferase 11
Genbank accession: NM_018413
Immunogen: CHST11 (NP_060883, 230 a.a. ~ 337 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: RKGDDVKFEEFVAYLIDPHTQREEPFNEHWQTVYSLCHPCHIHYDLVGKYETLEEDSNYVLQLAGVGSYLKFPTYAKSTRTTDEMTTEFFQNISSEHQTQLYEVYKLD
Protein accession: NP_060883
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00050515-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.62 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy CHST11 monoclonal antibody (M02), clone 1H3 now

Add to cart