Brand: | Abnova |
Reference: | H00050515-M01 |
Product name: | CHST11 monoclonal antibody (M01), clone 4F1 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CHST11. |
Clone: | 4F1 |
Isotype: | IgG1 Kappa |
Gene id: | 50515 |
Gene name: | CHST11 |
Gene alias: | C4ST|C4ST-1|C4ST1|HSA269537 |
Gene description: | carbohydrate (chondroitin 4) sulfotransferase 11 |
Genbank accession: | NM_018413 |
Immunogen: | CHST11 (NP_060883, 230 a.a. ~ 337 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | RKGDDVKFEEFVAYLIDPHTQREEPFNEHWQTVYSLCHPCHIHYDLVGKYETLEEDSNYVLQLAGVGSYLKFPTYAKSTRTTDEMTTEFFQNISSEHQTQLYEVYKLD |
Protein accession: | NP_060883 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.62 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | CHST11 monoclonal antibody (M01), clone 4F1 Western Blot analysis of CHST11 expression in K-562 ( Cat # L009V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |