CHST11 monoclonal antibody (M01), clone 4F1 View larger

CHST11 monoclonal antibody (M01), clone 4F1

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CHST11 monoclonal antibody (M01), clone 4F1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr

More info about CHST11 monoclonal antibody (M01), clone 4F1

Brand: Abnova
Reference: H00050515-M01
Product name: CHST11 monoclonal antibody (M01), clone 4F1
Product description: Mouse monoclonal antibody raised against a partial recombinant CHST11.
Clone: 4F1
Isotype: IgG1 Kappa
Gene id: 50515
Gene name: CHST11
Gene alias: C4ST|C4ST-1|C4ST1|HSA269537
Gene description: carbohydrate (chondroitin 4) sulfotransferase 11
Genbank accession: NM_018413
Immunogen: CHST11 (NP_060883, 230 a.a. ~ 337 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: RKGDDVKFEEFVAYLIDPHTQREEPFNEHWQTVYSLCHPCHIHYDLVGKYETLEEDSNYVLQLAGVGSYLKFPTYAKSTRTTDEMTTEFFQNISSEHQTQLYEVYKLD
Protein accession: NP_060883
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00050515-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.62 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00050515-M01-1-9-1.jpg
Application image note: CHST11 monoclonal antibody (M01), clone 4F1 Western Blot analysis of CHST11 expression in K-562 ( Cat # L009V1 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy CHST11 monoclonal antibody (M01), clone 4F1 now

Add to cart