CHST11 polyclonal antibody (A01) View larger

CHST11 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CHST11 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,ELISA,WB-Re

More info about CHST11 polyclonal antibody (A01)

Brand: Abnova
Reference: H00050515-A01
Product name: CHST11 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant CHST11.
Gene id: 50515
Gene name: CHST11
Gene alias: C4ST|C4ST-1|C4ST1|HSA269537
Gene description: carbohydrate (chondroitin 4) sulfotransferase 11
Genbank accession: NM_018413
Immunogen: CHST11 (NP_060883, 230 a.a. ~ 337 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: RKGDDVKFEEFVAYLIDPHTQREEPFNEHWQTVYSLCHPCHIHYDLVGKYETLEEDSNYVLQLAGVGSYLKFPTYAKSTRTTDEMTTEFFQNISSEHQTQLYEVYKLD
Protein accession: NP_060883
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00050515-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.99 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00050515-A01-2-A5-1.jpg
Application image note: CHST11 polyclonal antibody (A01). Western Blot analysis of CHST11 expression in human ovarian cancer.
Applications: WB-Ti,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy CHST11 polyclonal antibody (A01) now

Add to cart