COL5A3 monoclonal antibody (M01), clone 4B8 View larger

COL5A3 monoclonal antibody (M01), clone 4B8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of COL5A3 monoclonal antibody (M01), clone 4B8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about COL5A3 monoclonal antibody (M01), clone 4B8

Brand: Abnova
Reference: H00050509-M01
Product name: COL5A3 monoclonal antibody (M01), clone 4B8
Product description: Mouse monoclonal antibody raised against a partial recombinant COL5A3.
Clone: 4B8
Isotype: IgG2b Kappa
Gene id: 50509
Gene name: COL5A3
Gene alias: -
Gene description: collagen, type V, alpha 3
Genbank accession: NM_015719
Immunogen: COL5A3 (NP_056534, 157 a.a. ~ 244 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: EMVTLVADCEAQPPVLGHGPRFISIAGLTVLGTQDLGEKTFEGDIQELLISPDPQAAFQACERYLPDCDNLAPAATVAPQGEPETPRP
Protein accession: NP_056534
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00050509-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.42 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00050509-M01-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged COL5A3 is 0.3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy COL5A3 monoclonal antibody (M01), clone 4B8 now

Add to cart