CD207 purified MaxPab rabbit polyclonal antibody (D01P) View larger

CD207 purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CD207 purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse
Host speciesRabbit
ApplicationsWB-Ti,WB-Tr

More info about CD207 purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00050489-D01P
Product name: CD207 purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human CD207 protein.
Gene id: 50489
Gene name: CD207
Gene alias: CLEC4K
Gene description: CD207 molecule, langerin
Genbank accession: BC022278.1
Immunogen: CD207 (AAH22278.1, 1 a.a. ~ 328 a.a) full-length human protein.
Immunogen sequence/protein sequence: MTVEKEAPDAHFTVDKQNISLWPREPPPKSGPSLVPGKTPTVRAALICLTLVLVASVLLQAVLYPRFMGTISDVKTNVQLLKGRVDNISTLDSEIKKNSDGMEAAGVQIQMVNESLGYVRSQFLKLKTSVEKANAQIQILTRSWEEVSTLNAQIPELKSDLEKASALNTKIRALQGSLENMSKLLKRQNDILQVVSQGWKYFKGNFYYFSLIPKTWYSAEQFCVSRNSHLTSVTSESEQEFLYKTAGGLIYWIGLTKAGMEGDWSWVDDTPFNKVQSARFWIPGEPNNAGNNEHCGNIKAPSLQAWNDAPCDKTFLFICKRPYVPSEP
Protein accession: AAH22278.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human,Mouse
Application image: H00050489-D01P-13-15-1.jpg
Application image note: Western Blot analysis of CD207 expression in transfected 293T cell line (H00050489-T03) by CD207 MaxPab polyclonal antibody.

Lane 1: CD207 transfected lysate(36.70 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ti,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy CD207 purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart