Brand: | Abnova |
Reference: | H00050484-M01A |
Product name: | RRM2B monoclonal antibody (M01A), clone 6C1 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant RRM2B. |
Clone: | 6C1 |
Isotype: | IgG2a Kappa |
Gene id: | 50484 |
Gene name: | RRM2B |
Gene alias: | DKFZp686M05248|MGC102856|MGC42116|p53R2 |
Gene description: | ribonucleotide reductase M2 B (TP53 inducible) |
Genbank accession: | NM_015713 |
Immunogen: | RRM2B (NP_056528, 3 a.a. ~ 84 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | DPERPEAAGLDQDERSSSDTNESEIKSNEEPLLRKSSRRFVIFPIQYPDIWKMYKQAQASFWTAEEVDLSKDLPHWNKLKAD |
Protein accession: | NP_056528 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (34.76 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |