RRM2B monoclonal antibody (M01), clone 6C1 View larger

RRM2B monoclonal antibody (M01), clone 6C1

H00050484-M01_50ug

New product

395,00 € tax excl.

50 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RRM2B monoclonal antibody (M01), clone 6C1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,ELISA,WB-Re

More info about RRM2B monoclonal antibody (M01), clone 6C1

Brand: Abnova
Reference: H00050484-M01
Product name: RRM2B monoclonal antibody (M01), clone 6C1
Product description: Mouse monoclonal antibody raised against a partial recombinant RRM2B.
Clone: 6C1
Isotype: IgG2b Kappa
Gene id: 50484
Gene name: RRM2B
Gene alias: DKFZp686M05248|MGC102856|MGC42116|p53R2
Gene description: ribonucleotide reductase M2 B (TP53 inducible)
Genbank accession: NM_015713
Immunogen: RRM2B (NP_056528, 3 a.a. ~ 84 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: DPERPEAAGLDQDERSSSDTNESEIKSNEEPLLRKSSRRFVIFPIQYPDIWKMYKQAQASFWTAEEVDLSKDLPHWNKLKAD
Protein accession: NP_056528
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00050484-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (34.76 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00050484-M01-4-1-1-L.jpg
Application image note: Immunofluorescence of monoclonal antibody to RRM2B on HeLa cell . [antibody concentration 10 ug/ml]
Applications: IF,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: Ribonucleotide reductase small subunit p53R2 suppresses MEK-VERK activity by binding to ERK kinase 2.Piao C, Jin M, Kim HB, Lee SM, Amatya PN, Hyun JW, Chang IY, You HJ.
Oncogene. 2009 May 28;28(21):2173-84. Epub 2009 Apr 27.

Reviews

Buy RRM2B monoclonal antibody (M01), clone 6C1 now

Add to cart