Brand: | Abnova |
Reference: | H00050484-M01 |
Product name: | RRM2B monoclonal antibody (M01), clone 6C1 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant RRM2B. |
Clone: | 6C1 |
Isotype: | IgG2b Kappa |
Gene id: | 50484 |
Gene name: | RRM2B |
Gene alias: | DKFZp686M05248|MGC102856|MGC42116|p53R2 |
Gene description: | ribonucleotide reductase M2 B (TP53 inducible) |
Genbank accession: | NM_015713 |
Immunogen: | RRM2B (NP_056528, 3 a.a. ~ 84 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | DPERPEAAGLDQDERSSSDTNESEIKSNEEPLLRKSSRRFVIFPIQYPDIWKMYKQAQASFWTAEEVDLSKDLPHWNKLKAD |
Protein accession: | NP_056528 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (34.76 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunofluorescence of monoclonal antibody to RRM2B on HeLa cell . [antibody concentration 10 ug/ml] |
Applications: | IF,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Ribonucleotide reductase small subunit p53R2 suppresses MEK-VERK activity by binding to ERK kinase 2.Piao C, Jin M, Kim HB, Lee SM, Amatya PN, Hyun JW, Chang IY, You HJ. Oncogene. 2009 May 28;28(21):2173-84. Epub 2009 Apr 27. |