Brand: | Abnova |
Reference: | H00043847-M05 |
Product name: | KLK14 monoclonal antibody (M05), clone 2A7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant KLK14. |
Clone: | 2A7 |
Isotype: | IgG2b Kappa |
Gene id: | 43847 |
Gene name: | KLK14 |
Gene alias: | KLK-L6 |
Gene description: | kallikrein-related peptidase 14 |
Genbank accession: | NM_022046 |
Immunogen: | KLK14 (NP_071329.1, 152 a.a. ~ 251 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | SSPIARYPASLQCVNINISPDEVCQKAYPRTITPGMVCAGVPQGGKDSCQGDSGGPLVCRGQLQGLVSWGMERCALPGYPGVYTNLCKYRSWIEETMRDK |
Protein accession: | NP_071329.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged KLK14 is 0.3 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA |
Shipping condition: | Dry Ice |