KLK14 monoclonal antibody (M05), clone 2A7 View larger

KLK14 monoclonal antibody (M05), clone 2A7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of KLK14 monoclonal antibody (M05), clone 2A7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about KLK14 monoclonal antibody (M05), clone 2A7

Brand: Abnova
Reference: H00043847-M05
Product name: KLK14 monoclonal antibody (M05), clone 2A7
Product description: Mouse monoclonal antibody raised against a partial recombinant KLK14.
Clone: 2A7
Isotype: IgG2b Kappa
Gene id: 43847
Gene name: KLK14
Gene alias: KLK-L6
Gene description: kallikrein-related peptidase 14
Genbank accession: NM_022046
Immunogen: KLK14 (NP_071329.1, 152 a.a. ~ 251 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: SSPIARYPASLQCVNINISPDEVCQKAYPRTITPGMVCAGVPQGGKDSCQGDSGGPLVCRGQLQGLVSWGMERCALPGYPGVYTNLCKYRSWIEETMRDK
Protein accession: NP_071329.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00043847-M05-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged KLK14 is 0.3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy KLK14 monoclonal antibody (M05), clone 2A7 now

Add to cart