TAX1BP3 monoclonal antibody (M02), clone 1H5 View larger

TAX1BP3 monoclonal antibody (M02), clone 1H5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TAX1BP3 monoclonal antibody (M02), clone 1H5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about TAX1BP3 monoclonal antibody (M02), clone 1H5

Brand: Abnova
Reference: H00030851-M02
Product name: TAX1BP3 monoclonal antibody (M02), clone 1H5
Product description: Mouse monoclonal antibody raised against a full-length recombinant TAX1BP3.
Clone: 1H5
Isotype: IgG1 Kappa
Gene id: 30851
Gene name: TAX1BP3
Gene alias: TIP-1
Gene description: Tax1 (human T-cell leukemia virus type I) binding protein 3
Genbank accession: BC023980
Immunogen: TAX1BP3 (AAH23980, 1 a.a. ~ 124 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MSYIPGQPVTAVVQRVEIHKLRQGENLILGFSIGGGIDQDPSQNPFSEDKTDKGIYVTRVSEGGPAEIAGLQIGDKIMQVNGWDMTMVTHDQARKRLTKRSEEVVRLLVTRQSLQKAVQQSMLS
Protein accession: AAH23980
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00030851-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (39.38 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy TAX1BP3 monoclonal antibody (M02), clone 1H5 now

Add to cart