Brand: | Abnova |
Reference: | H00030851-M02 |
Product name: | TAX1BP3 monoclonal antibody (M02), clone 1H5 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant TAX1BP3. |
Clone: | 1H5 |
Isotype: | IgG1 Kappa |
Gene id: | 30851 |
Gene name: | TAX1BP3 |
Gene alias: | TIP-1 |
Gene description: | Tax1 (human T-cell leukemia virus type I) binding protein 3 |
Genbank accession: | BC023980 |
Immunogen: | TAX1BP3 (AAH23980, 1 a.a. ~ 124 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MSYIPGQPVTAVVQRVEIHKLRQGENLILGFSIGGGIDQDPSQNPFSEDKTDKGIYVTRVSEGGPAEIAGLQIGDKIMQVNGWDMTMVTHDQARKRLTKRSEEVVRLLVTRQSLQKAVQQSMLS |
Protein accession: | AAH23980 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (39.38 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |