TAX1BP3 monoclonal antibody (M01), clone 4A10 View larger

TAX1BP3 monoclonal antibody (M01), clone 4A10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TAX1BP3 monoclonal antibody (M01), clone 4A10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about TAX1BP3 monoclonal antibody (M01), clone 4A10

Brand: Abnova
Reference: H00030851-M01
Product name: TAX1BP3 monoclonal antibody (M01), clone 4A10
Product description: Mouse monoclonal antibody raised against a full length recombinant TAX1BP3.
Clone: 4A10
Isotype: IgG1 kappa
Gene id: 30851
Gene name: TAX1BP3
Gene alias: TIP-1
Gene description: Tax1 (human T-cell leukemia virus type I) binding protein 3
Genbank accession: BC023980
Immunogen: TAX1BP3 (AAH23980, 1 a.a. ~ 124 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MSYIPGQPVTAVVQRVEIHKLRQGENLILGFSIGGGIDQDPSQNPFSEDKTDKGIYVTRVSEGGPAEIAGLQIGDKIMQVNGWDMTMVTHDQARKRLTKRSEEVVRLLVTRQSLQKAVQQSMLS
Protein accession: AAH23980
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00030851-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (39.38 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00030851-M01-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged TAX1BP3 is approximately 0.1ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: The HPV16 E6 binding protein Tip-1 interacts with ARHGEF16, which activates Cdc42.Oliver AW, He X, Borthwick K, Donne AJ, Hampson L, Hampson IN.
Br J Cancer. 2010 Dec 7. [Epub ahead of print]

Reviews

Buy TAX1BP3 monoclonal antibody (M01), clone 4A10 now

Add to cart