PIK3R4 monoclonal antibody (M03), clone 1G12 View larger

PIK3R4 monoclonal antibody (M03), clone 1G12

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PIK3R4 monoclonal antibody (M03), clone 1G12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr

More info about PIK3R4 monoclonal antibody (M03), clone 1G12

Brand: Abnova
Reference: H00030849-M03
Product name: PIK3R4 monoclonal antibody (M03), clone 1G12
Product description: Mouse monoclonal antibody raised against a partial recombinant PIK3R4.
Clone: 1G12
Isotype: IgG2a Kappa
Gene id: 30849
Gene name: PIK3R4
Gene alias: MGC102700|VPS15|p150
Gene description: phosphoinositide-3-kinase, regulatory subunit 4
Genbank accession: NM_014602
Immunogen: PIK3R4 (NP_055417, 1259 a.a. ~ 1358 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: AGSDMKIRFWDLAYPERSYVVAGSTSSPSVSYYRKIIEGTEVVQEIQNKQKVGPSDDTPRRGPESLPVGHHDIITDVATFQTTQGFIVTASRDGIVKVWK
Protein accession: NP_055417
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00030849-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00030849-M03-1-1-1.jpg
Application image note: PIK3R4 monoclonal antibody (M03), clone 1G12 Western Blot analysis of PIK3R4 expression in HeLa ( Cat # L013V1 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice
Publications: Class III PI3K regulates organismal glucose homeostasis by providing negative feedback on hepatic insulin signalling.Nemazanyy I, Montagnac G, Russell RC, Morzyglod L, Burnol AF, Guan KL, Pende M, Panasyuk G.
Nat Commun. 2015 Sep 21;6:8283.

Reviews

Buy PIK3R4 monoclonal antibody (M03), clone 1G12 now

Add to cart