Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of PIK3R4 monoclonal antibody (M03), clone 1G12
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr |
More info about PIK3R4 monoclonal antibody (M03), clone 1G12
| Brand: | Abnova |
| Reference: | H00030849-M03 |
| Product name: | PIK3R4 monoclonal antibody (M03), clone 1G12 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant PIK3R4. |
| Clone: | 1G12 |
| Isotype: | IgG2a Kappa |
| Gene id: | 30849 |
| Gene name: | PIK3R4 |
| Gene alias: | MGC102700|VPS15|p150 |
| Gene description: | phosphoinositide-3-kinase, regulatory subunit 4 |
| Genbank accession: | NM_014602 |
| Immunogen: | PIK3R4 (NP_055417, 1259 a.a. ~ 1358 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | AGSDMKIRFWDLAYPERSYVVAGSTSSPSVSYYRKIIEGTEVVQEIQNKQKVGPSDDTPRRGPESLPVGHHDIITDVATFQTTQGFIVTASRDGIVKVWK |
| Protein accession: | NP_055417 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | PIK3R4 monoclonal antibody (M03), clone 1G12 Western Blot analysis of PIK3R4 expression in HeLa ( Cat # L013V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Class III PI3K regulates organismal glucose homeostasis by providing negative feedback on hepatic insulin signalling.Nemazanyy I, Montagnac G, Russell RC, Morzyglod L, Burnol AF, Guan KL, Pende M, Panasyuk G. Nat Commun. 2015 Sep 21;6:8283. |