PIK3R4 monoclonal antibody (M01), clone 1D4 View larger

PIK3R4 monoclonal antibody (M01), clone 1D4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PIK3R4 monoclonal antibody (M01), clone 1D4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab

More info about PIK3R4 monoclonal antibody (M01), clone 1D4

Brand: Abnova
Reference: H00030849-M01
Product name: PIK3R4 monoclonal antibody (M01), clone 1D4
Product description: Mouse monoclonal antibody raised against a partial recombinant PIK3R4.
Clone: 1D4
Isotype: IgG2a Kappa
Gene id: 30849
Gene name: PIK3R4
Gene alias: MGC102700|VPS15|p150
Gene description: phosphoinositide-3-kinase, regulatory subunit 4
Genbank accession: NM_014602
Immunogen: PIK3R4 (NP_055417, 1259 a.a. ~ 1358 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: AGSDMKIRFWDLAYPERSYVVAGSTSSPSVSYYRKIIEGTEVVQEIQNKQKVGPSDDTPRRGPESLPVGHHDIITDVATFQTTQGFIVTASRDGIVKVWK
Protein accession: NP_055417
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00030849-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00030849-M01-1-1-1.jpg
Application image note: PIK3R4 monoclonal antibody (M01), clone 1D4 Western Blot analysis of PIK3R4 expression in HeLa ( Cat # L013V1 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab
Shipping condition: Dry Ice

Reviews

Buy PIK3R4 monoclonal antibody (M01), clone 1D4 now

Add to cart