CTAG2 monoclonal antibody (M04), clone 3H1 View larger

CTAG2 monoclonal antibody (M04), clone 3H1

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CTAG2 monoclonal antibody (M04), clone 3H1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about CTAG2 monoclonal antibody (M04), clone 3H1

Brand: Abnova
Reference: H00030848-M04
Product name: CTAG2 monoclonal antibody (M04), clone 3H1
Product description: Mouse monoclonal antibody raised against a partial recombinant CTAG2.
Clone: 3H1
Isotype: IgG2b Kappa
Gene id: 30848
Gene name: CTAG2
Gene alias: CAMEL|ESO2|LAGE-1|LAGE-2b|MGC138724|MGC3803
Gene description: cancer/testis antigen 2
Genbank accession: NM_020994
Immunogen: CTAG2 (NP_066274, 111 a.a. ~ 210 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: RDAAPLPRPGAVLKDFTVSGNLLFMSVRDQDREGAGRMRVVGWGLGSASPEGQKARDLRTPKHKVSEQRPGTPGPPPPEGAQGDGCRGVAFNVMFSAPHI
Protein accession: NP_066274
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00030848-M04-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.11 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00030848-M04-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged CTAG2 is approximately 0.1ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy CTAG2 monoclonal antibody (M04), clone 3H1 now

Add to cart