EHD3 monoclonal antibody (M01), clone 4B7 View larger

EHD3 monoclonal antibody (M01), clone 4B7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of EHD3 monoclonal antibody (M01), clone 4B7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re

More info about EHD3 monoclonal antibody (M01), clone 4B7

Brand: Abnova
Reference: H00030845-M01
Product name: EHD3 monoclonal antibody (M01), clone 4B7
Product description: Mouse monoclonal antibody raised against a partial recombinant EHD3.
Clone: 4B7
Isotype: IgG1 Kappa
Gene id: 30845
Gene name: EHD3
Gene alias: PAST3
Gene description: EH-domain containing 3
Genbank accession: NM_014600
Immunogen: EHD3 (NP_055415, 357 a.a. ~ 406 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: KRMQDQLQAQDFSKFQPLKSKLLEVVDDMLAHDIAQLMVLVRQEESQRPI
Protein accession: NP_055415
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00030845-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (31.24 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00030845-M01-3-8-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to EHD3 on formalin-fixed paraffin-embedded human liver. [antibody concentration 3 ug/ml]
Applications: WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: The HIV-1 protein Vpr impairs phagosome maturation by controlling microtubule-dependent trafficking.Dumas A, Le-Bury G, Marie-Anais F, Herit F, Mazzolini J, Guilbert T, Bourdoncle P, Russell DG, Benichou S, Zahraoui A, Niedergang F.
J Cell Biol. 2015 Oct 26;211(2):359-72.

Reviews

Buy EHD3 monoclonal antibody (M01), clone 4B7 now

Add to cart