EHD3 polyclonal antibody (A01) View larger

EHD3 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of EHD3 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse,Rat
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about EHD3 polyclonal antibody (A01)

Brand: Abnova
Reference: H00030845-A01
Product name: EHD3 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant EHD3.
Gene id: 30845
Gene name: EHD3
Gene alias: PAST3
Gene description: EH-domain containing 3
Genbank accession: NM_014600
Immunogen: EHD3 (NP_055415, 357 a.a. ~ 406 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: KRMQDQLQAQDFSKFQPLKSKLLEVVDDMLAHDIAQLMVLVRQEESQRPI
Protein accession: NP_055415
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00030845-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (31.61 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Mouse,Rat
Application image: H00030845-A01-1-19-1.jpg
Application image note: EHD3 polyclonal antibody (A01), Lot # 060703JCS1. Western Blot analysis of EHD3 expression in IMR-32.
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy EHD3 polyclonal antibody (A01) now

Add to cart