Brand: | Abnova |
Reference: | H00030835-M01 |
Product name: | CD209 monoclonal antibody (M01), clone 3B10 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CD209. |
Clone: | 3B10 |
Isotype: | IgG2a Kappa |
Gene id: | 30835 |
Gene name: | CD209 |
Gene alias: | CDSIGN|CLEC4L|DC-SIGN|DC-SIGN1|MGC129965 |
Gene description: | CD209 molecule |
Genbank accession: | NM_021155 |
Immunogen: | CD209 (NP_066978.1, 271 a.a. ~ 380 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | SNSQRNWHDSITACKEVGAQLVVIKSAEEQNFLQLQSSRSNRFTWMGLSDLNQEGTWQWVDGSPLLPSFKQYWNRGEPNNVGEEDCAEFSGNGWNDDKCNLAKFWICKKS |
Protein accession: | NP_066978.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged CD209 is 1 ng/ml as a capture antibody. |
Applications: | IF,S-ELISA,ELISA,IP |
Shipping condition: | Dry Ice |