Brand: | Abnova |
Reference: | H00030835-D01P |
Product name: | CD209 purified MaxPab rabbit polyclonal antibody (D01P) |
Product description: | Rabbit polyclonal antibody raised against a full-length human CD209 protein. |
Gene id: | 30835 |
Gene name: | CD209 |
Gene alias: | CDSIGN|CLEC4L|DC-SIGN|DC-SIGN1|MGC129965 |
Gene description: | CD209 molecule |
Genbank accession: | NM_021155 |
Immunogen: | CD209 (NP_066978.1, 1 a.a. ~ 404 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MSDSKEPRLQQLGLLEEEQLRGLGFRQTRGYKSLAGCLGHGPLVLQLLSFTLLAGLLVQVSKVPSSISQEQSRQDAIYQNLTQLKAAVGELSEKSKLQEIYQELTQLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTWLKAAVGELPEKSKMQEIYQELTRLKAAVGELPEKSKQQEIYQELTRLKAAVGELPEKSKQQEIYQELTRLKAAVGELPEKSKQQEIYQELTQLKAAVERLCHPCPWEWTFFQGNCYFMSNSQRNWHDSITACKEVGAQLVVIKSAEEQNFLQLQSSRSNRFTWMGLSDLNQEGTWQWVDGSPLLPSFKQYWNRGEPNNVGEEDCAEFSGNGWNDDKCNLAKFWICKKSAASCSRDEEQFLSPAPATPNPPPA |
Protein accession: | NP_066978.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse |
Application image: |  |
Application image note: | CD209 MaxPab rabbit polyclonal antibody. Western Blot analysis of CD209 expression in human liver. |
Applications: | WB-Ti,WB-Tr |
Shipping condition: | Dry Ice |
Publications: | Intriguing interplay between feline infectious peritonitis virus and its receptors during entry in primary feline monocytes.Van Hamme E, Desmarets L, Dewerchin HL, Nauwynck HJ. Virus Res. 2011 May 12. [Epub ahead of print] |