ZNRD1 monoclonal antibody (M01), clone 6C12 View larger

ZNRD1 monoclonal antibody (M01), clone 6C12

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ZNRD1 monoclonal antibody (M01), clone 6C12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about ZNRD1 monoclonal antibody (M01), clone 6C12

Brand: Abnova
Reference: H00030834-M01
Product name: ZNRD1 monoclonal antibody (M01), clone 6C12
Product description: Mouse monoclonal antibody raised against a partial recombinant ZNRD1.
Clone: 6C12
Isotype: IgG1 Kappa
Gene id: 30834
Gene name: ZNRD1
Gene alias: HTEX-6|MGC13376|Rpa12|TEX6|hZR14|tctex-6
Gene description: zinc ribbon domain containing 1
Genbank accession: NM_014596
Immunogen: ZNRD1 (NP_055411, 24 a.a. ~ 126 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: GSVLPLPGAQDTVTCIRCGFNINVRDFEGKVVKTSVVFHQLGTAMPMSVEEGPECQGPVVDRRCPRCGHEGMAYHTRQMRSADEGQTVFYTCTNCKFQEKEDS
Protein accession: NP_055411
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00030834-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.07 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00030834-M01-13-15-1.jpg
Application image note: Western Blot analysis of ZNRD1 expression in transfected 293T cell line by ZNRD1 monoclonal antibody (M01), clone 6C12.

Lane 1: ZNRD1 transfected lysate(13.9 KDa).
Lane 2: Non-transfected lysate.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy ZNRD1 monoclonal antibody (M01), clone 6C12 now

Add to cart